Mobirise favicon

Mobirise

paid

Free website builder with AI

427.4k monthly visits
Visit website
official socials:
mobirise website

Mobirise is a free, offline website builder software for Windows and Mac that allows users to create responsive websites without coding. It provides a drag-and-drop interface with pre-made blocks for elements like menus, galleries, sliders, and contact forms. Users can visually edit content and media, and publish sites to their own hosting, a free Mobirise subdomain, or a custom domain. The software also offers an AI-powered online counterpart, Mobirise AI, which can generate complete websites from a text prompt. Mobirise includes features such as e-commerce integration via PayPal and Stripe, social feed extensions, a code editor for HTML/CSS customization, and a popup builder. It is based on Bootstrap 5 and is mobile-friendly by default.

starting price

$10/mo/ monthly(kit)

integrations
paypalstripewhatsapptelegramvibermessenger
quick ai search (for more info)

Sponsored

Loading Analytics...

Our Blog

Read insightful stories, practical guides, and expert perspectives on artificial intelligence, emerging technologies, and the ideas shaping tomorrow.